PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020352
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 340aa    MW: 37330.1 Da    PI: 8.8246
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020352genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.94.9e-2578122145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  Lus10020352  78 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVES 122
                  79****************************************997 PP

2QLQ65.71.1e-221652137
          QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 s+FT +Q+q+L++Q+l+yKy++a++PvPp+L+++iqk
  Lus10020352 16 SPFTVSQWQELEHQALIYKYMMAGVPVPPDLMLPIQK 52
                 89*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.0E-141652IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.5681752IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.4E-161751IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.76278122IPR014977WRC domain
PfamPF088794.0E-2179121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MSSGGGGTST VTMMRSPFTV SQWQELEHQA LIYKYMMAGV PVPPDLMLPI QKSFDSISPS  60
FFHHPSLGYC SFYGKKVDPE PGRCRRTDGK KWRCSKDAYP DSKYCERHMH RGRNRSRKPV  120
ESSSQQTTII TQSSTATTPT AAGTVVIDNN SGIGGFHHHA FSNPVSGNNQ SPYHHHLDSI  180
PYAIPSKDYR YLQGVKAEAS SNRGNFTNNE DSSAWPLMQS RVSSSSFSTS KSTPMNDYSS  240
NQPFLNFAEP AEKQHESQSL RPFFDEWPKT RGGGGGGKSW SELDHHDDSS RSNASFSSTT  300
QLSISIPTMA SPDMISTSSR SSPSESSNVS SKLPSNLFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3824882e-62FQ382488.1 Vitis vinifera clone SS0ABG55YD19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470089.11e-120PREDICTED: growth-regulating factor 4-like
TrEMBLA0A0B0N4371e-123A0A0B0N437_G
STRINGVIT_16s0039g01450.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47812951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-46growth-regulating factor 5